PNC-27 Product Description
PNC-27 belongs to the chimeric peptide class, in which a defined protein-binding motif is fused to a cell-penetrating or membrane-residency sequence. Its amino-terminal segment, PPLSQETFSDLWKLL, reproduces residues 12 to 26 of the p53 protein. Its carboxyl-terminal segment, KKWKMRRNQFWVKVQRG, supplies the membrane-penetrating leader.
The compound is prepared by solid-phase peptide synthesis and purified by reversed-phase HPLC. It carries no post-translational modification, no fluorophore, and no conjugated carrier in this format.
Research interest in PNC-27 centers on a physical chemistry question rather than a signaling one. The peptide is examined for how a p53-derived sequence adopts an HDM-2 binding conformation and what happens at a lipid bilayer when that binding partner is present in the membrane rather than the nucleus.
Compound Specifications
| Property | Value |
|---|---|
| CAS Number | 1159861-00-3 |
| PubChem CID | 16201774 |
| Molecular Formula | C₁₈₈H₂₉₃N₅₃O₄₄S |
| Molecular Weight | 4032 g/mol |
| Monoisotopic Mass | 4029.2040 Da |
| InChIKey | MZCACYLMMMXSKC-KOCFKOPYSA-N |
| Amino Acid Sequence (One-Letter) | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Amino Acid Sequence (Three-Letter) | Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly |
| Sequence Length | 32 residues |
| Source | Synthetic |
| Purity | ≥99% (HPLC) |
| Appearance | Lyophilized white powder |
| Solubility | Soluble in water; aqueous solubility of ≥100 mg/mL has been reported for the free peptide |
| Storage | -20°C, protect from light |
Storage and Handling
- Store the lyophilized compound at -20°C in the sealed vial, protected from light and moisture.
- After reconstitution, store at 2°C to 8°C and use promptly; for longer holds, aliquot and store at -20°C to avoid repeated freeze-thaw cycles.
- Allow the vial to reach ambient temperature before opening so condensation does not enter the powder.
- Maintain aseptic handling to preserve compound integrity.
Lyophilized Format
This compound ships in lyophilized (freeze-dried) form. Freeze-drying supports long-term storage stability and preserves compound integrity. No fillers are added.
PNC-27 Peptide Structure
Source: PubChem
