PNC-27 (10mg)

PNC-27 is a synthetic chimeric peptide of 32 residues that joins the p53 residue 12 to 26 segment, which carries the HDM-2 binding domain, to a 17-residue membrane-penetrating leader sequence. It is produced through controlled solid-phase peptide synthesis and supplied as a lyophilized powder in a 10mg vial with no fillers added. The peptide is characterized in laboratory work on peptide interaction with HDM-2 associated with the plasma membrane. It is studied for membrane pore formation and for selectivity between transformed and non-transformed cultured cell lines.

$279.97

Availability: In stock

- +
Buy in bulk and save (not applicable with other sales)
SKU PNC27-10MG Categories , Brand:

PNC-27 Product Description

PNC-27 belongs to the chimeric peptide class, in which a defined protein-binding motif is fused to a cell-penetrating or membrane-residency sequence. Its amino-terminal segment, PPLSQETFSDLWKLL, reproduces residues 12 to 26 of the p53 protein. Its carboxyl-terminal segment, KKWKMRRNQFWVKVQRG, supplies the membrane-penetrating leader.

The compound is prepared by solid-phase peptide synthesis and purified by reversed-phase HPLC. It carries no post-translational modification, no fluorophore, and no conjugated carrier in this format.

Research interest in PNC-27 centers on a physical chemistry question rather than a signaling one. The peptide is examined for how a p53-derived sequence adopts an HDM-2 binding conformation and what happens at a lipid bilayer when that binding partner is present in the membrane rather than the nucleus.

Compound Specifications

Property Value
CAS Number 1159861-00-3
PubChem CID 16201774
Molecular Formula C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight 4032 g/mol
Monoisotopic Mass 4029.2040 Da
InChIKey MZCACYLMMMXSKC-KOCFKOPYSA-N
Amino Acid Sequence (One-Letter) PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Amino Acid Sequence (Three-Letter) Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly
Sequence Length 32 residues
Source Synthetic
Purity ≥99% (HPLC)
Appearance Lyophilized white powder
Solubility Soluble in water; aqueous solubility of ≥100 mg/mL has been reported for the free peptide
Storage -20°C, protect from light

Storage and Handling

  • Store the lyophilized compound at -20°C in the sealed vial, protected from light and moisture.
  • After reconstitution, store at 2°C to 8°C and use promptly; for longer holds, aliquot and store at -20°C to avoid repeated freeze-thaw cycles.
  • Allow the vial to reach ambient temperature before opening so condensation does not enter the powder.
  • Maintain aseptic handling to preserve compound integrity.

Lyophilized Format

This compound ships in lyophilized (freeze-dried) form. Freeze-drying supports long-term storage stability and preserves compound integrity. No fillers are added.

PNC-27 Peptide Structure

32 Amino acid peptide.png

Source: PubChem

PNC-27 Research

PNC-27 research has focused on its mechanism of action, selectivity for cancer cells, and potential as a broad-spectrum anti-cancer agent, including its effects on primary tumors and chemoresistant cancers.

Membrane Pore Formation

PNC-27 contains a segment from the p53 protein that binds to HDM-2 on cancer cell membranes. This binding leads to the formation of transmembrane pores, causing rapid necrosis of cancer cells by allowing cell contents to leak out.[1] The peptide forms 1:1 complexes with HDM-2, which then dimerize to create these pores.[1]

Selectivity for Cancer Cells

PNC-27 targets cancer cells because they express high levels of membrane-bound HDM-2, unlike normal cells, which have little or none. This selectivity results in minimal toxicity to normal cells, including hematopoietic stem cells and other non-cancerous tissues.[1]

Broad Anticancer Activity

PNC-27 has demonstrated cytotoxicity against a wide range of solid and hematopoietic tumors, including chemotherapy-resistant cancers and primary tumor cells from ovarian and uterine cancers. The anticancer peptide has also shown efficacy in animal models, eradicating metastatic pancreatic tumors and leukemia stem cells. [1][2][3]

Primary Tumor Studies

Ex vivo studies on freshly isolated primary human ovarian and uterine cancer cells confirmed that PNC-27 induces dose-dependent cell death, with no observed effect on normal cells.[2]

References

  1. Pincus, M., Silberstein, M., Zohar, N., Sarafraz‐Yazdi, E., & Bowne, W. (2024). Poptosis or Peptide-Induced Transmembrane Pore Formation: A Novel Way to Kill Cancer Cells without Affecting Normal Cells. Biomedicines, 12. https://doi.org/10.3390/biomedicines12061144.
  2. Sarafraz‐Yazdi, E., Salame, G., Gorelick, C., Wagreich, A., Angert, M., Abulafia, O., Pincus, M., & Michl, J. (2011). Abstract C44: Ex vivo cytotoxicity of PNC-27 on primary human ovarian and endometrial cancers. Cancer Research, 71. https://doi.org/10.1158/1538-7445.FBCR11-C44.
  3. Wang, H., Zhao, D., Nguyen, L., Wu, H., Li, L., Dong, D., Troadec, E., Zhu, Y., Hoang, D., Stein, A., Malki, M., Aldoss, I., Lin, A., Ghoda, L., McDonald, T., Pichiorri, F., Carlesso, N., Kuo, Y., Zhang, B., Jin, J., & Marcucci, G. (2019). Targeting cell membrane HDM2: A novel therapeutic approach for acute myeloid leukemia. Leukemia, 34, 75-86. https://doi.org/10.1038/s41375-019-0522-9.

Certificate of Analysis (COA) for Every Batch

A Certificate of Analysis (COA) is a document that verifies a compound’s identity, purity, and batch quality through independent laboratory testing. Every compound from BioLongevity Labs ships with a COA tied to its specific batch, so researchers can confirm exactly what they received before it enters a protocol.

Each COA reports results from third-party laboratory analysis, including:

  • Ultra-high-performance liquid chromatography with mass spectrometry (UHPLC-MS) for purity, typically confirmed at 99% or higher
  • Mass identification for molecular confirmation and content quantitation
  • Endotoxin quantitation by Limulus amebocyte lysate (LAL) assay where applicable
  • Visual and physical characterization of the finished material

How to verify a COA independently

Every certificate can be checked against the issuing laboratory’s own records, not just the copy hosted here. Verification does not depend on BioLongevity Labs.

  • MDx BioAnalytical Laboratory certificates carry a QC tracking number and a search code. Newer certificates also carry a QR code. Scan the code, or enter the search code at mdxbiolabs.com, to pull the official record.
  • BioRegen reports of analysis carry a Report ID and a Validation Key. Scan the QR code on the certificate to open the official record, or reference both identifiers when contacting the laboratory at the address printed on the report.
  • SafeCert Labs certificates, which appear on a number of earlier batches, carry a COA number and the signature of the reporting chemist. Reference that number when requesting confirmation from the laboratory directly.

Batches are frequently tested by both laboratories independently. When two certificates exist for the same lot, each one resolves at its own issuing laboratory, which lets a researcher confirm the same material twice through two unrelated sources.

COAs are sourced from independent certified labs rather than in-house testing alone, giving researchers a verifiable record of molecular integrity for each batch. All compounds are supplied for research use only.

Review the COAs for this batch below, or browse the full COA library.

Endotoxin PNC-27

Endotoxin PNC-27

PNC-27 (11359)

PNC-27 (11359)

PNC-27 (251520)

PNC-27 (251520)

PNC-27 (251520E)

PNC-27 (251520E)

Browse our full peptide catalog featuring research compounds for a wide range of scientific applications:

Our Flagship Products

99%+ Purity, Third Party Tested

Independently verified by three separate certified laboratories. COAs available pre-purchase.

GMP Manufacturing Standards

Synthesized in USA-registered facilities following Good Manufacturing Practices. Full chain of custody documentation.

Best In Class Fulfillment

Same-day shipping on orders before 12 PM PT. Free standard domestic shipping on orders over $400.

Zero Fillers or Additives

Pure active compounds only. Independently verified composition for reliable in vitro studies.

Scientific Reviewer

Scientifically reviewed by Dr. Ky H. Le, MD. Dr. Le is a board-certified family medicine physician with over 20 years of clinical experience. Dr. Le validates the scientific accuracy of all technical content and research citations.

Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.
Glass vial with metal and rubber cap labeled PNC-27 10MG 99% Purity from Biolongevity Labs.PNC-27 (10mg)
$279.97

Availability: In stock

- +