FOXO4-DRI Peptide Description
FOXO4-DRI (FOXO4-D-Retro-Inverso) is a synthetic peptide designed to disrupt the interaction between the FOXO4 transcription factor and p53, a key regulator of apoptosis. This disruption allows p53 to induce apoptosis in senescent cells, which are cells that have stopped dividing and contribute to aging and various diseases. The peptide has shown promise in selectively targeting and eliminating senescent cells, thereby restoring tissue homeostasis and offering potential therapeutic benefits in several conditions.
Peptide Information
| Property |
Value |
| Peptide Sequence |
LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids) |
| Molecular Formula |
C228H388N86O64 |
| Molecular Weight |
5358 g/mol |
| CAS Number |
2460055-10-9 |
| Synonyms |
Forkhead box protein 04, Proxofim, FOXO4a, AFX, AFX1, MLLT7, FOXO 4-DRI, EX-A7431 |
FOXO4-D-Retro-Inverso Structure

Source: Uniprot
Certificate of Analysis (COA) for Every Batch
A Certificate of Analysis (COA) is a document that verifies a compound’s identity, purity, and batch quality through independent laboratory testing. Every compound from BioLongevity Labs ships with a COA tied to its specific batch, so researchers can confirm exactly what they received before it enters a protocol.
Each COA reports results from third-party laboratory analysis, including:
- High-performance liquid chromatography (HPLC) for purity, typically confirmed at 99% or higher
- Liquid chromatography mass spectrometry (LC-MS) for molecular identity and mass confirmation
- Sterility and endotoxin screening where applicable
- Chemical contaminant and residual solvent checks
COAs are sourced from independent certified labs rather than in-house testing alone, giving researchers a verifiable record of molecular integrity for each batch. All compounds are supplied for research use only.
Review the COAs for this batch below, or browse the full COA library.
FOXO4-DRI (261245)

FOXO4-DR1(251430)

FOX04(2502050022)

×