Tesamorelin (10mg)

Tesamorelin is a synthetic 44-residue analog of growth hormone-releasing hormone (GHRH), produced through controlled peptide synthesis and stabilized by a trans-3-hexenoic acid group at the N-terminus. It is supplied as a lyophilized white powder in a 10mg vial for reconstitution under laboratory conditions. The compound is characterized in research on the growth hormone and IGF-1 axis, pituitary GHRH receptor signaling, and adipose tissue metabolism. All material is supplied for research use only.

$149.97

Availability: In stock

- +

Don't forget your BAC Water

Glass vial of Biolongevity Labs Reconstitution Solution, 30ml, containing deionized pure water and .9% benzyl alcohol, made in the USA.
Reconstitution Solution (30ml) (BAC Water)
$19.97
Buy in bulk and save (not applicable with other sales)

Tesamorelin Description

Tesamorelin is a synthetic peptide analog belonging to the GHRH-analog family, sharing the core 44-amino acid sequence of the endogenous releasing factor. The N-terminal lipid modification lengthens its serum persistence relative to native GHRH, which makes it a stable reference compound for laboratory work.

In research settings, the peptide is studied for how it interacts with pituitary GHRH receptors and the downstream growth hormone and IGF-1 signaling cascade. This places it in the same research area as other secretagogue compounds such as CJC-1295 and Ipamorelin.

Each batch is synthesized in a USA-registered GMP facility and characterized by HPLC and LC-MS. A batch-specific Certificate of Analysis is available before purchase.

Compound Specifications

Property Value
CAS Number 901758-09-6 (acetate)
PubChem CID 44147413
Molecular Formula C₂₂₃H₃₇₀N₇₂O₆₉S
Molecular Weight 5196 g/mol
UNII LGW5H38VE3
Amino Acid Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Sequence (3-letter) Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu
Sequence Length 44 residues
N-Terminal Modification trans-3-hexenoic acid
Counterion / Salt Form Acetate
Source Synthetic
Purity ≥99% (HPLC)
Appearance Lyophilized white powder
Solubility Soluble in water; sterile aqueous solution after reconstitution
Storage -20°C, protect from light

Storage and Handling

  • Store the lyophilized compound at -20°C, protected from light.
  • After reconstitution, store at 2°C to 8°C and use promptly.
  • Maintain aseptic handling to preserve compound integrity.

Peptide Structure

CID 44147413.png

Source: PubChem

Lyophilized Format

This compound ships in lyophilized (freeze-dried) form. Freeze-drying supports long-term storage stability and preserves compound integrity. No fillers are added.

Research Use Disclaimer

Tesamorelin is supplied for research use only. It is not a drug, food, cosmetic, or dietary supplement, has not been evaluated by the FDA, and is for research use only. By purchasing, the buyer confirms the compound will be used solely for in vitro research.

Tesamorelin Research

Tesamorelin is a stabilized analog of growth hormone-releasing hormone. The trans-3-hexenoic acid group at the N-terminus of its 44-residue sequence lengthens serum persistence relative to native GHRH. In research models the compound binds pituitary GHRH receptors and is associated with pulsatile release of growth hormone, with downstream changes in insulin-like growth factor-1 (IGF-1) and IGF binding protein-3 [1]. A broader overview of the compound sits in the Tesamorelin research guide.

In adult study populations, reductions in visceral adipose tissue have been reported alongside changes in triglyceride levels and preservation of glucose homeostasis, characterized through combined anabolic and lipolytic dynamics [2].

Beyond adipose quantity, research has examined the compound’s influence on tissue-level gene expression and composition.

Hepatic Gene-Pathway Signatures

A gene-set analysis of paired liver specimens reported increased expression of gene sets involved in oxidative phosphorylation and decreased expression of gene sets linked to inflammation, tissue repair, and cell division. These shifts correlated with a fibrosis-related gene score in the same analysis [3].

Separate analyses looked at fat quality and skeletal muscle. Adipose tissue density increased independent of changes in fat quantity [4], and truncal muscle density and area increased among study populations with reduced visceral adipose tissue [5]. A 2026 meta-analysis of randomized trials aggregated changes in body composition, hepatic fat fraction, and IGF-1 across adult study populations [6].

Research Area In Vitro Application
GHRH receptor signaling Assays of pituitary GHRH receptor binding and cAMP response in cell models
Growth hormone / IGF-1 axis Model systems examining growth hormone pulsatility and downstream IGF-1 signaling
Adipose tissue metabolism Cell-model study of lipolytic pathways and adipocyte lipid handling
Hepatic lipid pathways Gene-expression analysis of oxidative phosphorylation and lipid-metabolism gene sets
Peptide characterization Analytical study of a lipid-modified GHRH analog by HPLC and LC-MS

References

  1. Sattler, F. R. (2013). Growth hormone in the aging male. Best Practice & Research Clinical Endocrinology & Metabolism, 27(4), 541-555. https://doi.org/10.1016/j.beem.2013.05.003
  2. Stanley, T. L., Falutz, J., Marsolais, C., Morin, J., Soulban, G., Mamputu, J.-C., Assaad, H., Turner, R., & Grinspoon, S. K. (2012). Reduction in visceral adiposity is associated with an improved metabolic profile in HIV-infected patients receiving tesamorelin. Clinical Infectious Diseases, 54(11), 1642-1651. https://doi.org/10.1093/cid/cis251
  3. Fourman, L. T., Billingsley, J. M., Agyapong, G., Ho Sui, S. J., Feldpausch, M. N., Purdy, J., Zheng, I., Pan, C. S., Corey, K. E., Torriani, M., Kleiner, D. E., Hadigan, C. M., Stanley, T. L., Chung, R. T., & Grinspoon, S. K. (2020). Effects of tesamorelin on hepatic transcriptomic signatures in HIV-associated NAFLD. JCI Insight, 5(16), e140134. https://doi.org/10.1172/jci.insight.140134
  4. Lake, J. E., La, K., Erlandson, K. M., Adrian, S., Yenokyan, G., Scherzinger, A., Dubé, M. P., Stanley, T., Grinspoon, S., Falutz, J., Mamputu, J.-C., Marsolais, C., McComsey, G. A., & Brown, T. T. (2021). Tesamorelin improves fat quality independent of changes in fat quantity. AIDS, 35(9), 1395-1402. https://doi.org/10.1097/QAD.0000000000002897
  5. Adrian, S., Scherzinger, A., Sanyal, A., Lake, J. E., Falutz, J., Dubé, M. P., Stanley, T., Grinspoon, S., Mamputu, J.-C., Marsolais, C., Brown, T. T., & Erlandson, K. M. (2019). The growth hormone releasing hormone analogue, tesamorelin, decreases muscle fat and increases muscle area in adults with HIV. The Journal of Frailty & Aging, 8(3), 154-159. https://doi.org/10.14283/jfa.2018.45
  6. Badran, A. S., Helal, A., Shata, K. S., & Ayesh, H. (2026). Body composition, hepatic fat, metabolic, and safety outcomes of tesamorelin, a GHRH analogue, in HIV-associated lipodystrophy: A meta-analysis of randomized controlled trials. Obesity Research & Clinical Practice, 20(1), 2-12. https://doi.org/10.1016/j.orcp.2026.01.002

Certificate of Analysis (COA) for Every Batch

A Certificate of Analysis (COA) is a document that verifies a compound’s identity, purity, and batch quality through independent laboratory testing. Every compound from BioLongevity Labs ships with a COA tied to its specific batch, so researchers can confirm exactly what they received before it enters a protocol.

Each COA reports results from third-party laboratory analysis, including:

  • Ultra-high-performance liquid chromatography with mass spectrometry (UHPLC-MS) for purity, typically confirmed at 99% or higher
  • Mass identification for molecular confirmation and content quantitation
  • Endotoxin quantitation by Limulus amebocyte lysate (LAL) assay where applicable
  • Visual and physical characterization of the finished material

How to verify a COA independently

Every certificate can be checked against the issuing laboratory’s own records, not just the copy hosted here. Verification does not depend on BioLongevity Labs.

  • MDx BioAnalytical Laboratory certificates carry a QC tracking number and a search code. Newer certificates also carry a QR code. Scan the code, or enter the search code at mdxbiolabs.com, to pull the official record.
  • BioRegen reports of analysis carry a Report ID and a Validation Key. Scan the QR code on the certificate to open the official record, or reference both identifiers when contacting the laboratory at the address printed on the report.
  • SafeCert Labs certificates, which appear on a number of earlier batches, carry a COA number and the signature of the reporting chemist. Reference that number when requesting confirmation from the laboratory directly.

Batches are frequently tested by both laboratories independently. When two certificates exist for the same lot, each one resolves at its own issuing laboratory, which lets a researcher confirm the same material twice through two unrelated sources.

COAs are sourced from independent certified labs rather than in-house testing alone, giving researchers a verifiable record of molecular integrity for each batch. All compounds are supplied for research use only.

Review the COAs for this batch below, or browse the full COA library.

Tesamorelin (261477)

Tesamorelin (261477)

Tesamorelin (261414)

Tesamorelin (261414)

Tesamorelin (260400)

Tesamorelin (260400)

Tesamorelin (12031)

Tesamorelin (12031)

Endotoxin Tesamorelin

Endotoxin Tesamorelin

Tesamorelin (251539)

Tesamorelin (251539)

Tesamorelin (251539E)

Tesamorelin (251539E)

Tesamorelin

Tesamorelin

Tesamorelin BL-ENDO-250409-005

Tesamorelin BL-ENDO-250409-005

Tesamorelin(10166)

Tesamorelin(10166)

Tesamorelin(10174)

Tesamorelin(10174)

Browse our full peptide catalog featuring research compounds for a wide range of scientific applications:

Our Flagship Products

99%+ Purity, Third Party Tested

Independently verified by three separate certified laboratories. COAs available pre-purchase.

GMP Manufacturing Standards

Synthesized in USA-registered facilities following Good Manufacturing Practices. Full chain of custody documentation.

Best In Class Fulfillment

Same-day shipping on orders before 12 PM PT. Free standard domestic shipping on orders over $400.

Zero Fillers or Additives

Pure active compounds only. Independently verified composition for reliable in vitro studies.

Scientific Reviewer

Scientifically reviewed by Dr. Ky H. Le, MD. Dr. Le is a board-certified family medicine physician with over 20 years of clinical experience. Dr. Le validates the scientific accuracy of all technical content and research citations.

Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.
Glass vial with cap labeled Tesamorelin 10MG 99% Purity from Biolongevity Labs.Tesamorelin (10mg)
$149.97

Availability: In stock

- +

Don't forget your BAC Water

Glass vial of Biolongevity Labs Reconstitution Solution, 30ml, containing deionized pure water and .9% benzyl alcohol, made in the USA.
Reconstitution Solution (30ml) (BAC Water)
$19.97