Tesamorelin and Ipamorelin (Blend) (8mg)

This Tesamorelin/Ipamorelin blend combines Tesamorelin, a growth hormone-releasing hormone (GHRH) analogue, with Ipamorelin, a selective growth hormone secretagogue, to facilitate controlled studies of growth hormone pathways. The complementary mechanisms of these peptides may work together to potentially enhance body composition, support tissue repair, and improve metabolic parameters.

$115.00

Availability: In stock

- +
Buy in bulk and save (not applicable with other sales)
SKU TESA-IPA-8MG Categories , Tag

Tesamorelin and Ipamorelin Blend Product Description

The Tesamorelin/Ipamorelin blend combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models.

This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg).

Tesamorelin and Ipamorelin Peptide Structure

Tesamorelin

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

Molecular Formula: C223H370N72O69S

Molecular Weight: 5196 g/mol

PubChem CID: 44147413

CAS Number: 901758-09-6

Synonyms:

  • Tesamorelin acetate
  • 901758-09-6
  • TH9507
  • UNII-LGW5H38VE3
  • Tesamorelin acetate [USAN]

Ipamorelin

Sequence: Aib-His-D-2Nal-D-Phe-Lys

Molecular Formula: C38H49N9O5

Molecular Weight: 711.9 g/mol

PubChem CID: 9831659

CAS Number: 170851-70-4

Synonyms:

  • 170851-70-4
  • Ipamorelin [INN]
  • NNC-26-0161
  • UNII-Y9M3S784Z6

Lyophilized Peptides:

These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.

Tesamorelin and Ipamorelin Research

Laboratory research on Tesamorelin and Ipamorelin reveals complementary mechanisms affecting growth hormone pathways. While each peptide stimulates GH release through different receptor interactions, their combined effects may extend beyond simple hormone elevation.

Current research demonstrates their individual influences on visceral fat reduction, muscle preservation, gastrointestinal function, and bone metabolism.

Effects on Growth Hormone Release

Tesamorelin is a GHRH analog that has been shown to augment basal and pulsatile GH secretion. It significantly increases IGF-1 levels. A study involving healthy subjects showed that tesamorelin treatment increased mean overnight GH, average log(10) GH peak area, and basal GH secretion1.

Ipamorelin is a pentapeptide with distinct GH-releasing properties. It mimics ghrelin and binds to the ghrelin receptor (GHSR) in the brain, selectively stimulating GH release from the pituitary gland, which increases plasma GH levels. Ipamorelin’s GH release selectivity is similar to that of GHRH2.

Lipolysis

Tesamorelin has demonstrated efficacy in reducing visceral adipose tissue (VAT) in HIV patients with lipodystrophy3. Studies have shown significant declines in VAT, hepatic fat, and trunk-to-appendicular fat ratio with tesamorelin treatment. It also reduces liver fat and improves liver enzymes4.

Ipamorelin stimulates appetite and enhances gastric motility. Research indicates it accelerates gastrointestinal transit and may ameliorate symptoms of postoperative ileus. In a rodent model, repetitive dosing of ipamorelin increased fecal pellet output, food intake, and body weight gain5.

Muscle Growth

Tesamorelin can increase skeletal muscle area and density. Among individuals with a clinically significant decrease in visceral adipose tissue, tesamorelin was effective in increasing the density of truncal muscle groups and the total area of the rectus and psoas muscles6.

In an adult rat model, ipamorelin counteracted the catabolic effects of glucocorticoids on skeletal muscles. Simultaneous administration of ipamorelin with glucocorticoids increased the maximum tetanic tension of calf muscles7.

Bone Density

Ipamorelin has been shown to increase bone mineral content (BMC) in young adult female rats. However, when corrected for body weight, total BMC was unaffected. The increase in cortical BMC was attributed to increased cross-sectional bone area, while cortical volumetric BMD remained unchanged8.

References

  1. Stanley, T. L., Chen, C. Y., Branch, K. L., Makimura, H., & Grinspoon, S. K. (2011). Effects of a growth hormone-releasing hormone analog on endogenous GH pulsatility and insulin sensitivity in healthy men. The Journal of clinical endocrinology and metabolism96(1), 150–158. https://doi.org/10.1210/jc.2010-1587
  2. Raun, K., Hansen, B. S., Johansen, N. L., Thøgersen, H., Madsen, K., Ankersen, M., & Andersen, P. H. (1998). Ipamorelin, the first selective growth hormone secretagogue. European journal of endocrinology139(5), 552–561. https://doi.org/10.1530/eje.0.1390552
  3. Linda M. Spooner & J. L. Olin. (2012). Tesamorelin: A Growth Hormone-Releasing Factor Analogue for HIV-Associated Lipodystrophy. In Annals of Pharmacotherapy. https://doi.org/10.1345/aph.1Q629
  4. Fourman, L.T., Czerwonka, N., Feldpausch, M.N., Weiss, J.J., Mamputu, J., Falutz, J.M., Morin, J., Marsolais, C., Stanley, T.L., & Grinspoon, S.K. (2017). Visceral fat reduction with tesamorelin is associated with improved liver enzymes in HIV. AIDS, 31, 2253–2259.
  5. Venkova, K., Mann, W.R., Nelson, R.L., & Meerveld, B.G. (2009). Efficacy of Ipamorelin, a Novel Ghrelin Mimetic, in a Rodent Model of Postoperative Ileus. Journal of Pharmacology and Experimental Therapeutics, 329, 1110 – 1116. https://doi.org/10.1124/jpet.108.149211
  6. Adrian, S., Scherzinger, A., Sanyal, A., Lake, J.E., Falutz, J., Dubé, M.P., Stanley, T.L., Grinspoon, S.K., Mamputu, J., Marsolais, C., Brown, T.T., & Erlandson, K.M. (2018). The Growth Hormone Releasing Hormone Analogue, Tesamorelin, Decreases Muscle Fat and Increases Muscle Area in Adults with HIV. The Journal of Frailty & Aging, 8, 154-159. https://doi.org/10.14283/jfa.2018.45
  7. Andersen, N. B., Malmlöf, K., Johansen, P. B., Andreassen, T. T., Ørtoft, G., & Oxlund, H. (2001). The growth hormone secretagogue ipamorelin counteracts glucocorticoid-induced decrease in bone formation of adult rats. Growth hormone & IGF research : official journal of the Growth Hormone Research Society and the International IGF Research Society11(5), 266–272. https://doi.org/10.1054/ghir.2001.0239
  8. Svensson, J., Lall, S., Dickson, S. L., Bengtsson, B. A., Rømer, J., Ahnfelt-Rønne, I., Ohlsson, C., & Jansson, J. O. (2000). The GH secretagogues ipamorelin and GH-releasing peptide-6 increase bone mineral content in adult female rats. The Journal of endocrinology165(3), 569–577. https://doi.org/10.1677/joe.0.1650569

Certificate of Analysis (COA) for Every Batch

A Certificate of Analysis (COA) is a document that verifies a compound’s identity, purity, and batch quality through independent laboratory testing. Every compound from BioLongevity Labs ships with a COA tied to its specific batch, so researchers can confirm exactly what they received before it enters a protocol.

Each COA reports results from third-party laboratory analysis, including:

  • Ultra-high-performance liquid chromatography with mass spectrometry (UHPLC-MS) for purity, typically confirmed at 99% or higher
  • Mass identification for molecular confirmation and content quantitation
  • Endotoxin quantitation by Limulus amebocyte lysate (LAL) assay where applicable
  • Visual and physical characterization of the finished material

How to verify a COA independently

Every certificate can be checked against the issuing laboratory’s own records, not just the copy hosted here. Verification does not depend on BioLongevity Labs.

  • MDx BioAnalytical Laboratory certificates carry a QC tracking number and a search code. Newer certificates also carry a QR code. Scan the code, or enter the search code at mdxbiolabs.com, to pull the official record.
  • BioRegen reports of analysis carry a Report ID and a Validation Key. Scan the QR code on the certificate to open the official record, or reference both identifiers when contacting the laboratory at the address printed on the report.
  • SafeCert Labs certificates, which appear on a number of earlier batches, carry a COA number and the signature of the reporting chemist. Reference that number when requesting confirmation from the laboratory directly.

Batches are frequently tested by both laboratories independently. When two certificates exist for the same lot, each one resolves at its own issuing laboratory, which lets a researcher confirm the same material twice through two unrelated sources.

COAs are sourced from independent certified labs rather than in-house testing alone, giving researchers a verifiable record of molecular integrity for each batch. All compounds are supplied for research use only.

Review the COAs for this batch below, or browse the full COA library.

Tesamorelin/Ipamorelin (261478)

Tesamorelin/Ipamorelin (261478)

Tesamorelin/Ipamorelin (12020)

Tesamorelin/Ipamorelin (12020)

Tesamorelin / Ipamorelin (12020)

Tesamorelin / Ipamorelin (12020)

Tesamorelin / Ipamorelin (260264)

Tesamorelin / Ipamorelin (260264)

Endotoxin Tesamorelin/ Ipamorelin

Endotoxin Tesamorelin/ Ipamorelin

Tesamorelin With Ipamorelin (251540)

Tesamorelin With Ipamorelin (251540)

Tesamorelin With Ipamorelin (251540E)

Tesamorelin With Ipamorelin (251540E)

Tesamorelin/Ipamorelin (251446)

Tesamorelin/Ipamorelin (251446)

Tesamorelin/Ipamorelin (250967)

Tesamorelin/Ipamorelin (250967)

Tesamorelin / Ipamorelin COA10174 – Tesamorelin Component

Tesamorelin / Ipamorelin COA10174 – Tesamorelin Component

Tesamorelin / Ipamorelin COA10174 – Ipamorelin Component

Tesamorelin / Ipamorelin COA10174 – Ipamorelin Component

Browse our full peptide catalog featuring research compounds for a wide range of scientific applications:

Our Flagship Products

99%+ Purity, Third Party Tested

Independently verified by three separate certified laboratories. COAs available pre-purchase.

GMP Manufacturing Standards

Synthesized in USA-registered facilities following Good Manufacturing Practices. Full chain of custody documentation.

Best In Class Fulfillment

Same-day shipping on orders before 12 PM PT. Free standard domestic shipping on orders over $400.

Zero Fillers or Additives

Pure active compounds only. Independently verified composition for reliable in vitro studies.

Scientific Reviewer

Scientifically reviewed by Dr. Ky H. Le, MD. Dr. Le is a board-certified family medicine physician with over 20 years of clinical experience. Dr. Le validates the scientific accuracy of all technical content and research citations.

Disclaimer: For Research Purposes Only

This content is provided strictly for research purposes and does not constitute an endorsement or recommendation for the non-laboratory application or improper handling of peptides designed for research. The information, including discussions about specific peptides and their researched benefits, is presented for informational purposes only and must not be construed as health, clinical, or legal guidance, nor an encouragement for non-research use. Peptides described here are solely for use in structured scientific study by authorized individuals. We advise consulting with research experts, medical practitioners, or legal counsel prior to any decisions about obtaining or utilizing these peptides. The expectation of responsible, ethical utilization of this information for legitimate investigative and scholarly objectives is paramount. This notice is dynamic and governs all provided content on research peptides.
Glass vial of Biolongevity Labs Tesamorelin/Ipamorelin, 6/2MG, with purity exceeding 99%, made in the USATesamorelin and Ipamorelin (Blend) (8mg)
$115.00

Availability: In stock

- +